.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.0 Angstrom Crystal structure of Glutamate--Cysteine Ligase (gshA) ftom Francisella tularensis in Complex with AMP. To be Published
    Site CSGID
    PDB Id 3nzt Target Id IDP01828
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS48408,177416, 56707518 Molecular Weight 56903.78 Da.
    Residues 501 Isoelectric Point 6.24
    Sequence mydfkkinnlrgieretlrvtdcgnlatsnhpdglghkltnnsitvdfsenllelitkphdsidkaige lyqlsaftldnmhsdeiilntsmplsandndiqeadfgssnsgrmkrvyrkglsarygkimqiisgihy nfsfdkdlisniatnkqvsisdiyfdvlnnyfefmwllpylfgaspicaktsvknkpdylsvlddkfyv geyatslrmsdlgytspaqkdlaisydnvkayvkdliqatddtfadykriglynsqgqriqlndgilqi eneyysairpkqiakrgerpacalynrgveyvevrvldvdpfepvgiskdtalfvevmlmtcldkdakk yhkdiikqakqnltavaiqgrnpqlklkkldddseillkdyalelfdeieavakkmpkeyldaveiqkr kvldisqtpsakiielarqhgykkfildisrrvsqqfrsyelpaaivaklkdqagqsvaaekelvandk isldeyinryyksskgcc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.19598
    Matthews' coefficent 2.96 Rfactor 0.16390
    Waters 333 Solvent Content 58.38

    Ligand Information
    Ligands AMP (ADENOSINE) x 1;SO4 (SULFATE) x 11
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch