.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o1k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative dihydroneopterin aldolase (FolB) from Vibrio cholerae O1 biovar El Tor str. N16961. To be Published
    Site CSGID
    PDB Id 3o1k Target Id IDP01380
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS48394,243277, 15640546 Molecular Weight 14577.20 Da.
    Residues 129 Isoelectric Point 6.13
    Sequence mgirpvnrkrlsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvs qavlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierarg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.24619
    Matthews' coefficent 2.37 Rfactor 0.19413
    Waters 135 Solvent Content 48.02

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch