.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o7m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.98 Angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from Bacillus anthracis str. 'Ames Ancestor'. TO BE PUBLISHED
    Site CSGID
    PDB Id 3o7m Target Id IDP01634
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS48400,IDP01634, 47530373, YP_021722 Molecular Weight 20826.88 Da.
    Residues 183 Isoelectric Point 5.08
    Sequence mnieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvtidfisassy gnqtettgkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkalkfctlldkperrkvdl taeyvgfqipdefivgygidcaekyrnlpfiasvvteesynlksr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.98 Rfree 0.20595
    Matthews' coefficent 2.66 Rfactor 0.16723
    Waters 566 Solvent Content 53.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch