.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o8q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.45 Angstrom Resolution Crystal Structure of Shikimate 5-Dehydrogenase (aroE) from Vibrio cholerae. TO BE PUBLISHED
    Site CSGID
    PDB Id 3o8q Target Id IDP90792
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS48468,243277, 15640088 Molecular Weight 30247.92 Da.
    Residues 278 Isoelectric Point 6.44
    Sequence masqidqyavfgnpinhskspfihtlfarqtqqsmiytaqcvpvdgfteaakhffaqggrgcnvtvpfk eeayrfadrlterarlagavntlkklddgeilgdntdgeglvqdllaqqvllkgatilligaggaargv lkplldqqpasitvtnrtfakaeqlaelvaaygevkaqafeqlkqsydviinstsasldgelpaidpvi fssrsvcydmmygkgytvfnqwarqhgcaqaidglgmlvgqaaesfmlwrglrpgtkqilrelrknlegal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.19455
    Matthews' coefficent 2.03 Rfactor 0.15182
    Waters 554 Solvent Content 39.40

    Ligand Information
    Ligands SO4 (SULFATE) x 4;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals NA (SODIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch