.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oet

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title D-Erythronate-4-Phosphate Dehydrogenase complexed with NAD. To be Published
    Site CSGID
    PDB Id 3oet Target Id IDP90820
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS48471,99287, 16765697 Molecular Weight 41296.03 Da.
    Residues 378 Isoelectric Point 5.64
    Sequence mkilvdenmpyarelfsrlgevkavpgrpipveelnhadalmvrsvtkvnesllsgtpinfvgtatagt dhvdeawlkqagigfsaapgcnaiavveyvfsallmlaerdgfslrdrtigivgvgnvgsrlqtrleal girtllcdppraargdegdfrtldelvqeadvltfhtplykdgpyktlhladetlirrlkpgailinac rgpvvdnaallarlnagqplsvvldvwegepdlnvalleavdigtshiagytlegkargttqvfeaysa figreqrvaletllpapefgritlhgpldqptlkrlahlvydvrrddaplrkvagipgefdklrknyle rrewsslyvmcddetaaallcklgfnavhhpah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.36 Rfree 0.25331
    Matthews' coefficent 2.42 Rfactor 0.19030
    Waters 558 Solvent Content 49.25

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 8
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch