.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ojc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Asp/Glu Racemase from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3ojc Target Id IDP04122
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS49682,214092, 115348441 Molecular Weight 25307.73 Da.
    Residues 231 Isoelectric Point 5.58
    Sequence mmkilgliggmswestipyyrminqhvkaqlgglhsakiilysvdfheieqlqakgdwqtaaqllsnaa islkhagaevivvctntmhkvaddieaacglpllhiadatavqikqqgidkigllgtrytmeqgfyrgr ltekhgievitpddtdreavnriiyeelclgiisetsrdayrrvikkleaqgvqgiifgcteitllvna qdasvpvfdttaihasaaadyalq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.75 Rfree 0.2015
    Matthews' coefficent 2.21 Rfactor 0.1699
    Waters 751 Solvent Content 44.30

    Ligand Information
    Ligands HEZ (HEXANE-1,6-DIOL) x 20
    Metals CA (CALCIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch