.
The Open Protein Structure Annotation Network
PDB Keyword
.

3op4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with NADP+. TO BE PUBLISHED
    Site CSGID
    PDB Id 3op4 Target Id IDP90557
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS48446,243277, 15642023 Molecular Weight 26058.45 Da.
    Residues 248 Isoelectric Point 5.98
    Sequence msqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgmalnvtnpes ieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrlskavlrgmmkkrqgrii nvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvntvapgfietdmtkalndeqrtatlaq vpagrlgdpreiasavaflaspeaayitgetlhvnggmymi
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.17510
    Matthews' coefficent 2.18 Rfactor 0.14733
    Waters Solvent Content 43.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch