.
The Open Protein Structure Annotation Network
PDB Keyword
.

3os4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Nicotinate Phosphoribosyltransferase from Yersinia pestis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3os4 Target Id IDP90895
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS49758,214092, 16121693 Molecular Weight 46019.42 Da.
    Residues 401 Isoelectric Point 6.10
    Sequence mtqdaspiltslldtdayklhmqqavfhhyrhitvaaefrcrsdellgvyadeirhqvtlmgqlaltsd efiylsslpffqddylhwlrdfrfkpeqvsvavhdgkldiriaglwcevimwevpllaviseivhrrrs tqvttdqavqqlrtkleqfnalsadidithfklmdfgtrrrfsreiqhtvvstlkdefpylvgtsnydl artlalapvgtqahewfqahqqisptlansqrvalqvwldeypnqlgialtdcitmdaflrdfdlafan ryqglrhdsgdpiewgekaiahyeklgidpmkkvlvfsdnldlekalflyrhfyqriklvfgigtrltc dipdvkplniviklvecndkpvaklsdspgkticqdpafvdqlrkafalplvkkas
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.193
    Matthews' coefficent 2.08 Rfactor 0.162
    Waters Solvent Content 40.93

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch