.
The Open Protein Structure Annotation Network
PDB Keyword
.

3osc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    PDB Id 3osc Target Id IDP04423
    Related PDB Ids 3m3h 
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS48434,261594, 47529314 Molecular Weight 22712.74 Da.
    Residues 210 Isoelectric Point 5.49
    Sequence mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelikehfptvevia gtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaekgqkvvvvedlistggsaitcvealre agcevlgivsiftyeleagkekleaanvasyslsdysaltevaaekgiigqaetkklqewrknpadeaw ita
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch