.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ot1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of VC2308 protein. To be Published
    Site CSGID
    PDB Id 3ot1 Target Id IDP04323
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS49689,243277, 15642306 Molecular Weight 21735.90 Da.
    Residues 205 Isoelectric Point 5.43
    Sequence meqgmskrilvpvahgseemetviivdtlvragfqvtmaavgdklqvqgsrgvwltaeqtleacsaeaf dalalpggvggaqafadstallalidafsqqgklvaaicatpalvfakqqkfvgarmtchpnffdhips erlsrqrvcyyatqhlltsqgpgtalefalamiallagvelaqhvaapmvlhpqqltelsgfidaqs
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.16775
    Matthews' coefficent 1.90 Rfactor 0.14357
    Waters Solvent Content 35.24

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch