.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oug

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    PDB Id 3oug Target Id IDP02730
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS49641,177416, 56708440 Molecular Weight 12328.55 Da.
    Residues 111 Isoelectric Point 6.29
    Sequence mlisvlkskisyatvtgkdlfyvgsitidseimkqaniienekvqvvnlnngerletyvikgepnskti alngpaarrceigdqlfiisytqvdptrenikpklvdlktgd
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch