.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p09

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Beta-Lactamase from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3p09 Target Id IDP02545
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS80246,IDP02545, 56707736, YP_169632 Molecular Weight 31980.82 Da.
    Residues 287 Isoelectric Point 7.66
    Sequence mrllvttlslipsiilaapqlddsfknlenkydgkigiytlntddktnikynesyhfpicsvfkfllvg aildydmhnqgfldkkipinqddigklgyapitaknvgktltisqlnyaailsdspasnilvrelgglq nlnkfikklgdndtiitadepeinytqphsninkttpkaitkdiyklafgnildkkhkdifikylqdnn tganriafsmpkdwiigdktgtcgqyaatndvaiiwpknqqpialgilytnpndknapsneeiiqqaak liandltntyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.207
    Matthews' coefficent 2.01 Rfactor 0.162
    Waters 377 Solvent Content 38.91

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch