.
The Open Protein Structure Annotation Network
PDB Keyword
.

3q6d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Xaa-Pro dipeptidase from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3q6d Target Id IDP01139
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS80210,IDP01139, 30258918, AAP28136 Molecular Weight 38611.74 Da.
    Residues 353 Isoelectric Point 5.04
    Sequence mekierlrsafdeagidgilltnehsrrymanftgtagvvliskkraqfitdfryveqaskqavgyeiv qhagliidevakqvkelgiqklgfeqdtltyssysahkeaidaefiptsglveklrliktdseikilke aaqiadaafehilsfirpgvseievsneleffmrkqgatsssfdiivasglrsalphgvasekvietgd fvtldfgayykgycsditrtiavgepsdklkeiynivleaqlrgvngikagltgreadaltrdyitekg ygeyfghstghgigleiheapglafrsdtvlepgmavtvepgiyipgiggvrieddiivtsegnevitk spkeliil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.97 Rfree 0.24660
    Matthews' coefficent 2.61 Rfactor 0.19560
    Waters 653 Solvent Content 52.81

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch