.
The Open Protein Structure Annotation Network
PDB Keyword
.

3q88

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Glucose-6-phosphate isomerase from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3q88 Target Id IDP02733
    Related PDB Ids 3ljk 3m5p 3q7i 
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS31318,IDP02733, 56708372, YP_170268 Molecular Weight 61149.24 Da.
    Residues 540 Isoelectric Point 5.92
    Sequence mlfcddskkylkeqninlknefdkddkrvekfslkhqniyfdysknlindyilksllesaeksslkdki kqmfngakinstehravlhtalrdlsstplivdgqdirqevtkekqrvkelvekvvsgrwrgfsgkkit divnigiggsdlgpkmvvralqpyhctdlkvhfvsnvdadsllqalhvvdpettlfiiasksfsteetl lnsisarewlldhyedekavanhfvaisskldkvkefgidlehcykmwdwvggryslwssigmsiafai gydnfekllagaysvdkhfketefsknipvimallasyysctynsqsqallpyderlcyfvdylqqadm esngksvniagetvnyqtgvvlwggvgtngqhafhqllhqgnifipvdfiaiatshhnydnhqqallan cfaqsqalmfgqsydmvynellksglnetqakelaahkvipgnrpsttilldelspyslgalialyehk ifvqgvlwdinsydqwgvelgkklgknilkamnddssdeyqnlddstrqliakvknk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.1739
    Matthews' coefficent 2.60 Rfactor 0.1462
    Waters 483 Solvent Content 52.69

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch