.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qjg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Epidermin biosynthesis protein EpiD from Staphylococcus aureus. To be Published
    Site CSGID
    PDB Id 3qjg Target Id IDP00629
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS80184,IDP00629, 57284796, YP_186703 Molecular Weight 19592.50 Da.
    Residues 172 Isoelectric Point 5.55
    Sequence mgenvliclcgsvnsinishyiielkskfdevnviastngrkfingeilkqfcdnyydefedpflnhvd iankhdkiiilpatsntinkiangicdnllltichtafeklsifpnmnlrmwenpvtqnnirllkdygv siypanisesyelasktfkknvvapepykvlefi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.04 Rfree 0.2626
    Matthews' coefficent 2.88 Rfactor 0.2082
    Waters 1504 Solvent Content 57.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch