.
The Open Protein Structure Annotation Network
PDB Keyword
.

3r2e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Dihydroneopterin aldolase/dihydroneopterin triphosphate 2'-epimerase from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3r2e Target Id IDP90567
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS80334,IDP90567, 16120973, NP_404286 Molecular Weight 13390.59 Da.
    Residues 119 Isoelectric Point 4.84
    Sequence mdivfieelsvittigvydweqtiqqklvfdiemgwdnrkaagsddvndclsyadiseaviqhvgsqrf alvervaeevaelllrrfnspwvrikvskpgavaqaknvgviiergqrls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.2553
    Matthews' coefficent 2.14 Rfactor 0.2153
    Waters 11 Solvent Content 42.59

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch