.
The Open Protein Structure Annotation Network
PDB Keyword
.

3r2i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Superantigen-like Protein, Exotoxin SACOL0473 from Staphylococcus aureus subsp. aureus COL. TO BE PUBLISHED
    Site CSGID
    PDB Id 3r2i Target Id IDP00770
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS80200,IDP00770, 57285500, YP_185363 Molecular Weight 26674.40 Da.
    Residues 232 Isoelectric Point 9.14
    Sequence mklttiakatlalgilttgvftaesqtghakveldetqrkyyinmlhqyyseesfeptnisvksedyyg snvlnfkqrnkafkvfllgddknkykekthgldvfavpelidikggiysvggitkknvrsvfgfvsnps lqvkkvdakngfsinelffiqkeevslkeldfkirklliekyrlykgtsdkgrivinmkdekkheidls eklsfermfdvmdskqiknievnln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.25482
    Matthews' coefficent 2.20 Rfactor 0.18926
    Waters 119 Solvent Content 44.07

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch