.
The Open Protein Structure Annotation Network
PDB Keyword
.

3re3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3re3 Target Id IDP00331
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS80176,IDP00331, 56708205, YP_170101 Molecular Weight 17663.61 Da.
    Residues 159 Isoelectric Point 6.69
    Sequence msfrighgydvhkftsakqniiiggveiayhlgleahsdgdvlihalcdailgalglgdigkhfldtdn qfknidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmraclanileiqisqinikattte rlgfigreegiathvvcllyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.65 Rfree 0.227
    Matthews' coefficent 2.85 Rfactor 0.173
    Waters 63 Solvent Content 56.88

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch