.
The Open Protein Structure Annotation Network
PDB Keyword
.

3sc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.65 Angstrom resolution crystal structure of dTDP-4-dehydrorhamnose reductase (rfbD) from Bacillus anthracis str. Ames in complex with NADP. To be Published
    Site CSGID
    PDB Id 3sc6 Target Id IDP01195
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS80220,IDP01195, 30255180, AAP25189 Molecular Weight 32409.34 Da.
    Residues 284 Isoelectric Point 6.46
    Sequence mkerviitgangqlgkqlqeelnpeeydiypfdkkllditnisqvqqvvqeirphiiihcaaytkvdqa ekerdlayvinaigarnvavasqlvgaklvyistdyvfqgdrpegydefhnpapiniygaskyageqfv kelhnkyfivrtswlygkygnnfvktmirlgkereeisvvadqigsptyvadlnvminklihtslygty hvsntgscswfefakkifsyanmkvnvlpvsteefgaaaarpkysifqhnmlrlngflqmpsweegler ffietksh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.65 Rfree 0.25785
    Matthews' coefficent 3.32 Rfactor 0.21531
    Waters 241 Solvent Content 62.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch