.
The Open Protein Structure Annotation Network
PDB Keyword
.

3t41

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.95 Angstrom Resolution Crystal Structure of Epidermin Leader Peptide Processing Serine Protease (EpiP) S393A Mutant from Staphylococcus aureus. TO BE PUBLISHED
    Site CSGID
    PDB Id 3t41 Target Id IDP00624
    Related PDB Ids 3qfh 
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS80178,IDP00624, 57284795, YP_186702 Molecular Weight 50732.83 Da.
    Residues 457 Isoelectric Point 9.06
    Sequence mkiikraiisliilsllisitmsnasaseelyysveykntatfnklvkkkslnvvynipelhvaqikmt kmhanalanykndikyinatcstcitsektidrtsneslfsrqwdmnkitnngasyddlpkhantkiai idtgvmknhddlknnfstdsknlvplngfrgtepeetgdvhdvndrkghgtmvsgqtsangkligvapn nkftmyrvfgskktellwvskaivqaandgnqvinisvgsyiildkndhqtfrkdekveydalqkainy akkkksivvaaagndgidvndkqklklqreyqgngevkdvpasmdnvvtvgstdqksnlsefsnfgmny tdiaapggsfaylnqfgvdkwmnegymhkenilttanngryiyqagtslatpkvsgalaliidkyhlek hpdkaiellyqhgtsknnkpfsryghgeldvykalnvanqkas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.19477
    Matthews' coefficent 2.26 Rfactor 0.16597
    Waters 492 Solvent Content 45.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch