.
The Open Protein Structure Annotation Network
PDB Keyword
.

3tfc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase with an N-terminal chorismate mutase-like regulatory domain. Protein Sci. 21 887-895 2012
    Site CSGID
    PDB Id 3tfc Target Id IDP00348
    Related PDB Ids 3nvt 
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS48377,IDP00348, 16803640, NP_465125 Molecular Weight 39682.69 Da.
    Residues 361 Isoelectric Point 5.41
    Sequence mvntnleelrtqvdqlnidlleliskranlvqeigkikgtqgslrfdplreremlntilaanegpfeds tvqklfkeifkaglelqeedhskallvsrknkkedtivtvkglpigngepvfvfgpcsvesyeqvaava esikakglklirggafkprtspydfqglgleglkilkrvsdeyglgviseivtpadievaldyvdviqi garnmqnfellkaagrvdkpillkrglsatieefigaaeyimsqgngkiilcergirtyekatrntldi savpilkkethlpvmvdvthstgrkdlllpcakaalaieadgvmaevhpdpavalsdsaqqmdipefee fwnailasnlvphkik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.20466
    Matthews' coefficent 2.30 Rfactor 0.17468
    Waters 353 Solvent Content 46.45

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch