.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ti2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.90 Angstrom resolution crystal structure of N-terminal domain 3-phosphoshikimate 1-carboxyvinyltransferase from Vibrio cholerae. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ti2 Target Id IDP90626
    Related PDB Ids 3nvs 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS48454,IDP90626, 15641736, NP_231368 Molecular Weight 46099.06 Da.
    Residues 426 Isoelectric Point 5.01
    Sequence mesltlqpielisgevnlpgsksvsnralllaalasgttrltnlldsddirhmlnaltklgvnyrlsad kttceveglgqafhttqplelflgnagtamrplaaalclgqgdyvltgeprmkerpighlvdalrqaga qieyleqenfpplriqgtglqagtvtidgsissqfltaflmsaplaqgkvtikivgelvskpyiditlh imeqfgvqvinhdyqefvipagqsyvspgqflvegdassasyflaaaaikggevkvtgigknsiqgdiq fadalekmgaqiewgddyviarrgelnavdldfnhipdaamtiattalfakgttairnvynwrvketdr laamatelrkvgatveegedfivitpptklihaaidtyddhrmamcfslvalsdtpvtindpkctsktf pdyfdkfaqlsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.19557
    Matthews' coefficent 2.12 Rfactor 0.15107
    Waters 682 Solvent Content 42.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch