.
The Open Protein Structure Annotation Network
PDB Keyword
.

3tu3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Type III Secretion Effector Protein ExoU in Complex with Its Chaperone SpcU. Plos One 7 e49388-e49388 2012
    Site CSGID
    PDB Id 3tu3 Target Id IDP91634
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS80426,IDP91634, 2429143, AAC16023 Molecular Weight 73931.70 Da.
    Residues 687 Isoelectric Point 5.72
    Sequence mhiqslgatasslnqepvetpsqaahksaslrqepsgqglgvalkstpgilsgklpesvsdvrfsspqg qgesrtltdsagprqitlrqfengvtelqlsrppltslvlsgggakgaaypgamlaleekgmldgirsm sgssaggitaallasgmspaafktlsdkmdlislldssnkklklfqhisseigaslkkglgnkiggfse lllnvlpridsraeplerllrdetrkavlgqiathpevarqptvaaiasrlqsgsgvtfgdldrlsayi pqiktlnitgtamfegrpqlvvfnashtpdlevaqaahisgsfpgvfqkvslsdqpyqagvewtefqdg gvminvpvpemidknfdsgplrrndnlilefegeagevapdrgtrggalkgwvvgvpalqaremlqleg leelreqtvvvplksergdfsgmlggtlnftmpdeikahlqerlqervgehlekrlqaserhtfaslde allalddsmltsvaqqnpeitdgavafrqkardafteltvaivsanglagrlkldeamrsalqrldala dtperlawlaaelnhadnvdhqqlldamrgqtvqspvlaaalaeaqrrkvaviaenirkevifpslyrp gqpdsnvallrraeeqlrhatspaeinqalndivdnysargflrfgkplssttvemakawrnkeft
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.22459
    Matthews' coefficent 2.06 Rfactor 0.19124
    Waters 501 Solvent Content 40.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch