.
The Open Protein Structure Annotation Network
PDB Keyword
.

3u80

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a type II dehydroquinate dehydratase-like protein from Bifidobacterium longum. J.Struct.Funct.Genom. 14 25-30 2013
    Site CSGID
    PDB Id 3u80 Target Id IDP91202
    Molecular Characteristics
    Source Bifidobacterium longum subsp. infantis atcc 15697
    Alias Ids TPS80392,IDP91202, 189439473, NC_010816 Molecular Weight 16453.94 Da.
    Residues 148 Isoelectric Point 5.33
    Sequence mtkvivvngpnlgrlgvrqpdvygrqdldtlrklcaewgkdlglevevrqtddeaemvrwmhqaadekt pvvmnpaafthysyaladaahmvidenlplmevhisnpsardefrkrsvispvatgtitgmgfygykla ldavahllse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.20270
    Matthews' coefficent 1.95 Rfactor 0.17642
    Waters 220 Solvent Content 36.95

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch