.
The Open Protein Structure Annotation Network
PDB Keyword
.

3usb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Bacillus anthracis inosine 5'-monophosphate dehydrogenase in action: the first bacterial series of structures of phosphate ion-, substrate-, and product-bound complexes. Biochemistry 51 6148-6163 2012
    Site CSGID
    PDB Id 3usb Target Id IDP01178
    Related PDB Ids 3tsb 3tsd 
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS80212,IDP01178, 30253523, AAP24065 Molecular Weight 52371.66 Da.
    Residues 487 Isoelectric Point 6.30
    Sequence mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadmaiamarqggl giihknmsieqqaeqvdkvkrsesgvisdpffltpehqvydaehlmgkyrisgvpvvnnlderklvgii tnrdmrfiqdysikisdvmtkeqlitapvgttlseaekilqkykieklplvdnngvlqglitikdiekv iefpnsakdkqgrllvgaavgvtadamtridalvkasvdaivldtahghsqgvidkvkevrakypslni iagnvataeatkalieaganvvkvgigpgsicttrvvagvgvpqltavydcatearkhgipviadggik ysgdmvkalaagahvvmlgsmfagvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklv pegiegrvpykgpladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnysl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.38 Rfree 0.201
    Matthews' coefficent 2.36 Rfactor 0.170
    Waters 416 Solvent Content 47.91

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch