.
The Open Protein Structure Annotation Network
PDB Keyword
.

3uwq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.80 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with uridine-5'-monophosphate (UMP). To be Published
    Site CSGID
    PDB Id 3uwq Target Id IDP90525
    Related PDB Ids 3ldv 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS31323,IDP90525, 15641913, NP_231545 Molecular Weight 25001.49 Da.
    Residues 231 Isoelectric Point 5.88
    Sequence mndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldlkfhdipnt cskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvltsmesadlqgigilsapqd hvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgirpagseqgdqrrimtpaqaiasgsdyl vigrpitqaahpevvleeinsslv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.17787
    Matthews' coefficent 2.37 Rfactor 0.15020
    Waters 476 Solvent Content 48.05

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch