.
The Open Protein Structure Annotation Network
PDB Keyword
.

3v05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.4 Angstrom Crystal Structure of Superantigen-like Protein from Staphylococcus aureus. TO BE PUBLISHED
    Site CSGID
    PDB Id 3v05 Target Id IDP91125
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus nctc 8325
    Alias Ids TPS80388,IDP91125, 88194186, NC_007795 Molecular Weight 26654.33 Da.
    Residues 231 Isoelectric Point 9.20
    Sequence mklktlakatlvlgllatgvittesqtvkaaestqgqhnykslkyyyskpsielknldglyrqkvtdkg vyvwkdrkdyfvgllgkdiekypqgehdkqdaflvieeetvngrqysigglsktnskefskevdvkvtr kidessekskdskfkitkeeislkeldfklrkklmeeeklygavnnrkgkivvkmeddkfytfeltkkl qphrmgdtidgtkikeinveleyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.25967
    Matthews' coefficent 1.88 Rfactor 0.19486
    Waters 225 Solvent Content 34.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch