.
The Open Protein Structure Annotation Network
PDB Keyword
.

4dxe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.52 Angstrom resolution crystal structure of the acyl-carrier-protein synthase (AcpS)-acyl carrier protein (ACP) protein-protein complex from Staphylococcus aureus subsp. aureus COL. To be Published
    Site CSGID
    PDB Id 4dxe Target Id IDP00816
    Related PDB Ids 3f09 
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26769,IDP00816, 57284929, YP_186877 Molecular Weight 13604.88 Da.
    Residues 119 Isoelectric Point 6.65
    Sequence mihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatkeafskalgtgl gkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleksaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.51 Rfree 0.25449
    Matthews' coefficent Rfactor 0.19971
    Waters 134 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch