The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 Angstrom Resolution Crystal Structure of Transaldolase from Francisella tularensis (phosphate-free). TO BE PUBLISHED
    Site CSGID
    PDB Id 4e0c Target Id IDP02095
    Related PDB Ids 3igx 3te9 3tk7 3tkf 3tno 3upb 
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS30414,IDP02095, 56708176, YP_170072 Molecular Weight 35686.29 Da.
    Residues 321 Isoelectric Point 6.06
    Sequence mqksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvkannpdlns ddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiaryesngipkdrvlikiaa twegikaakllqkegincnltlifdkaqakacaeagvylvspfvgritdwqmqqnnlktfpaiadddgv nsvkaiyklykshgfktivmgasfrnveqvialagcdaltispvlleelknrdehlevkltknddvvtq spqiseadfrwlmnenamathklaegirlftkdtieleniikqnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.18917
    Matthews' coefficent 2.18 Rfactor 0.15062
    Waters 771 Solvent Content 43.53

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch