.
The Open Protein Structure Annotation Network
PDB Keyword
.

4e5s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MccFlike protein (BA_5613) from Bacillus anthracis str. Ames. To be Published
    Site CSGID
    PDB Id 4e5s Target Id IDP91764
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS80462,IDP91764, 30265388, NC_003997 Molecular Weight 36686.74 Da.
    Residues 328 Isoelectric Point 6.07
    Sequence mlptklkkgdeirvispscslsivstenrrlavkrltelgfhvtfsthaeeidrfasssissrvqdlhe afrdpnvkailttlggynsngllkyldydlirenpkffcgysditalnnaiytktglvtysgphfssfg mekgleyttdyflqcltsnkpievlpsetwsddswyidqenrkfiknegyvsihegeatgdiiggnmst lnllqgtsympnlkdkilfleedsltgtstlktfdrylhslmqqqnfkhvkgivigkmqkgaectiedi qemiaskpelahipiianasfghttpiftfpiggratiisskektsitilth
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.2021
    Matthews' coefficent 2.68 Rfactor 0.1530
    Waters 931 Solvent Content 54.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch