.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ecd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.5 Angstrom Resolution Crystal Structure of Bifidobacterium longum Chorismate Synthase. TO BE PUBLISHED
    Site CSGID
    PDB Id 4ecd Target Id IDP91213
    Molecular Characteristics
    Source Bifidobacterium longum subsp. infantis atcc 15697
    Alias Ids TPS80396,IDP91213, 189439475, NC_010816 Molecular Weight 42314.66 Da.
    Residues 395 Isoelectric Point 6.22
    Sequence mlrwqtageshgealvamieglpagvristddivsalarrrlgygrgarmkfeqdkvrlltgvrhgltl gspvaieiantewpkwtevmsadaldhdlpregrnaplsrprpghadltgmrkygfddarpvlerssar etasrvalgevakqfldqafgirtvahvvalggvqtnpdlplptpddlealdaspvrtldkeaevriie rineakkaadtlggvievlaygvpagigtyvesdrrldaalasaimgiqafkgveigdgflaasrpgsq ahdeivvnadgridrlsnraggieggmsngqvirvrgamkpipsipkalrtvdvltgesaqainqrsds tavpaasvvaeamvrltlakyaldkfggdsvaetrrnlesylaswpehmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.25347
    Matthews' coefficent 2.20 Rfactor 0.19702
    Waters 136 Solvent Content 44.19

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch