.
The Open Protein Structure Annotation Network
PDB Keyword
.

4eq9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.4 Angstrom Crystal Structure of Putative ABC Transporter Substrate-Binding Protein from Streptococcus pneumoniae strain Canada MDR_19A in Complex with Glutathione. TO BE PUBLISHED
    Site CSGID
    PDB Id 4eq9 Target Id IDP91961
    Molecular Characteristics
    Source Streptococcus pneumoniae str. canada mdr_19a
    Alias Ids TPS80516,IDP91961, 298255041, NZ_ACNU00000000 Molecular Weight 30626.05 Da.
    Residues 276 Isoelectric Point 5.14
    Sequence mkkivkysslaalglvaagvlaacsggakkegeaaskkeiivatngsprpfiyeengeltgyeievvra ifkdsdkydvkfektewsgvfagldadrynmavnnlsytkeraekylyaapiaqnpnvlvvkkddssik slddiggkstevvqattsakqleaynaehtdnptilnytkadfqqimvrlsdgqfdykifdkigvetvi knqgldnlkvielpsdqqpyvypllaqgqdelksfvdkrikelykdgtleklskqffgdtylpaeadik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.18993
    Matthews' coefficent 2.36 Rfactor 0.16770
    Waters 334 Solvent Content 47.98

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch