.
The Open Protein Structure Annotation Network
PDB Keyword
.

4h3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.95 Angstrom Crystal Structure of of Type I 3-Dehydroquinate Dehydratase (aroD) from Clostridium difficile with Covalent Modified Comenic Acid. TO BE PUBLISHED
    Site CSGID
    PDB Id 4h3d Target Id IDP90163
    Related PDB Ids 3js3 
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS30436,IDP90163, 172044608, Q186A6 Molecular Weight 28874.24 Da.
    Residues 255 Isoelectric Point 6.17
    Sequence mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenikevkevlyel rsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfmgdevidevvnfahkkevk viisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnekdvlvlleatnemfkiyadrpiitmsms gmgvisrlcgeifgsaltfgaaksvsapgqisfkelnsvlnllhksin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.19936
    Matthews' coefficent 2.37 Rfactor 0.15561
    Waters 836 Solvent Content 48.19

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch