.
The Open Protein Structure Annotation Network
PDB Keyword
.

4hus

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus in complex with virginiamycin M1. To be Published
    Site CSGID
    PDB Id 4hus Target Id IDP91546
    Related PDB Ids 4e8l 4hur 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS80416,IDP91546, 398085, AAA26683 Molecular Weight 24930.42 Da.
    Residues 219 Isoelectric Point 5.62
    Sequence mnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkliig rfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvwigrdvtimpgvk igdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqwwnldmkiinenlpfiingdie mlkrkrkllddt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.36 Rfree 0.2284
    Matthews' coefficent 2.83 Rfactor 0.1842
    Waters 535 Solvent Content 56.53

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch