.
The Open Protein Structure Annotation Network
PDB Keyword
.

4i62

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.05 Angstrom crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine. To be Published
    Site CSGID
    PDB Id 4i62 Target Id IDP91967
    Molecular Characteristics
    Source Streptococcus pneumoniae str. canada mdr_19a
    Alias Ids TPS80522,IDP91967, 298255704, NZ_ACNU00000000 Molecular Weight 29207.00 Da.
    Residues 268 Isoelectric Point 5.22
    Sequence mnkmkkvlmtmfglvmlpllfacsnnqsagieaikskgklvvalnpdfapfeyqkvvdgknqivgsdie lakaiatelgvelelspmsfdnvlasvqsgkadlaisgvsktderskvfdfstpyytaknklivkksdl atyqsvndlaqkkvgaqkgsiqetmakdllqnsslvslpkngnlitdlksgqvdavifeepvakgfven npdlaiadlnfekeqddsyavamkkdskelkeavdktiqklkesgeldkliedafkasiek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.05 Rfree 0.1793
    Matthews' coefficent 1.93 Rfactor 0.1659
    Waters 389 Solvent Content 27.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch