.
The Open Protein Structure Annotation Network
PDB Keyword
.

4iuo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 Angstrom Crystal Structure of the Salmonella enterica 3-Dehydroquinate Dehydratase (aroD) K170M Mutant in Complex with Quinate. TO BE PUBLISHED
    Site CSGID
    PDB Id 4iuo Target Id IDP90922
    Related PDB Ids 3l2i 3lb0 3m7w 3nnt 3o1n 3oex 3s42 4gfs 4guf 4gug 4guh 4gui 4guj 
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS31328,IDP90922, 16764709, NP_460324 Molecular Weight 27323.91 Da.
    Residues 252 Isoelectric Point 5.30
    Sequence mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesvleaagair eiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgddevkatvgyahqhnvav imsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadvltlltatvemqeryadrpiitmsmsk tgvisrlagevfgsaatfgavkkasapgqisvadlrtvltilhqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.20823
    Matthews' coefficent 1.91 Rfactor 0.17799
    Waters 435 Solvent Content 35.51

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch