.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ixh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Optimization of Benzoxazole-Based Inhibitors of Cryptosporidium parvum Inosine 5'-Monophosphate Dehydrogenase. J.Med.Chem. 56 4028-4043 2013
    Site CSGID
    PDB Id 4ixh Target Id IDP92622
    Molecular Characteristics
    Source Cryptosporidium parvum
    Alias Ids TPS80836,IDP92622, 323510309 Molecular Weight 43079.05 Da.
    Residues 400 Isoelectric Point 5.61
    Sequence mgtknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgmarlggig iihknmdmesqvnevlkvknwisnleknestpdqnldkestdgkdtksnnnidaysnenldnkgrlrvg aaigvneierakllveagvdvivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengad gikvgigpgsicttrivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigs ilagteespgekeligdtvykyyrgmgsvgamksgsgdryfqekrpenkmvpegiegrvkykgemegvv yqlvgglrscmgylgsasieelwkkssyveittsglreshvhdveivkevmnysk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.2103
    Matthews' coefficent 2.38 Rfactor 0.1616
    Waters 486 Solvent Content 48.39

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch