.
The Open Protein Structure Annotation Network
PDB Keyword
.

4k4l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Spermidine N1-acetyltransferase from Vibrio cholerae in complex with 2-[N-cyclohexylamino]ethane sulfonate. To be Published
    Site CSGID
    PDB Id 4k4l Target Id IDP01616
    Related PDB Ids 3eg7 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24754,IDP01616, 9658384, AAF96843 Molecular Weight 20674.38 Da.
    Residues 173 Isoelectric Point 5.60
    Sequence mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvvedaqknlig lvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiylhvavenpkavhlyeecg fveeghlveeffingryqdvkrmyilqskylnrse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.88 Rfree 0.2373
    Matthews' coefficent 2.61 Rfactor 0.1919
    Waters 283 Solvent Content 52.88

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch