.
The Open Protein Structure Annotation Network
PDB Keyword
.

4k6a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Revised Crystal Structure of apo-form of Triosephosphate Isomerase (tpiA) from Escherichia coli at 1.8 Angstrom Resolution. TO BE PUBLISHED
    Site CSGID
    PDB Id 4k6a Target Id IDP91829
    Molecular Characteristics
    Source Escherichia coli str. k-12 substr. mg1655
    Alias Ids TPS80504,IDP91829, 1790353, NC_000913 Molecular Weight 26970.31 Da.
    Residues 255 Isoelectric Point 5.64
    Sequence mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshimlgaqnvdln lsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqgltpvlcigeteaeneagk teevcarqidavlktqgaaafegaviayepvwaigtgksatpaqaqavhkfirdhiakvdaniaeqvii qyggsvnasnaaelfaqpdidgalvggaslkadafavivkaaeaakqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.18470
    Matthews' coefficent 1.96 Rfactor 0.14895
    Waters 569 Solvent Content 37.13

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch