.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00769

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Selected
    Target Id IDP00769
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS80198,IDP00769, 57285499, YP_185362 Molecular Weight 34138.38 Da.
    Residues 308 Isoelectric Point 9.64
    Sequence mkittiaktslalgllttgvittttqaanattpsstkveapqstppstkieapqskpnattppstkvea pqqtanattppstkvttppstntpqpmqstksdtpqspttkqvpteinpkfkdlrayytkpslefknei giilkkwttirfmnvvpdyfiykialvgkddkkygegvhrnvdvfvvleennynlekysvggitksnsk kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgkivikmkngg kytfelhkklqenrmadvinseqiknievnlk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch