.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00788

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP00788
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS80202,IDP00788, 57284414, YP_185908 Molecular Weight 57271.94 Da.
    Residues 493 Isoelectric Point 8.96
    Sequence mkkifmmvheldvnkggmtssmfnrskefydadipadivtfdykgnydeiikalkkqgkmdrrtkmynv feyfkqisnnkhfksnkllykhiserlkntieieeskgisryfdittgtyiayirksksekvidffkdn krierfsfidnkvhmketfnvdnkvcyqvfydekgypyisrninanngavgktyvlvnkkefknnlalc vyyleklikdskdsimicdgpgsfpkmfntnhknaqkygvihvnhhenfddtgafkksekyiienanki ngvivlteaqrldilnqfdveniftisnfvkihnapkhfqtekivghisrmvptkridllievaelvvk kdnavkfhiygegsvkdkiakmiedknlernvflkgytttpqkcledfklvvstsqyegqglsmieami skrpvvafdikygpsdfiednkngylienhnindmadkilqlvnndvlaaefgskareniiekystesi lekwlnlfns
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch