The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00856
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS33092,99287, 16763768 TM0388 Molecular Weight 19802.60 Da.
    Residues 181 Isoelectric Point 5.65
    Sequence mmqplylvgprgcgkttigmalaqatgfrfadtdrwlqshvqmsvadivekegwggfraretaaleavsa pstvvatgggiilteynrrymhrvgvviylcapvstlvnrleaepeadlrptltgkplseevrevleqr dalyretahyiidatkapaqvvseiiaalppstqrlqgdvyt
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch