The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP00859
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26244,99287, 16765111 TM1770 Molecular Weight 8948.42 Da.
    Residues 76 Isoelectric Point 6.83
    Sequence mpykaksdlpdnvrnvlpahaqdiykeafnsaweqykdkadrrddasreetahkvawaavkndyekgedd kwhkkk
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1770

    Name: 1-deoxy-D-xylulose 5-phosphate synthase
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : g3p + h + pyr --> co2 + dxyl5p


    Ligand Information
    Model TM1770
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch