The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00871
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26238,99287, 161353603 TM1444 Molecular Weight 16421.13 Da.
    Residues 144 Isoelectric Point 6.24
    Sequence mesplgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqpslvrtldql edkglisrqtcasdrrakrikltekadaliaemeevihktrgeilagisseeiellikliaklehnime lhshd
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1444

    Name: 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase (ipdp)
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : h + h2mb4p + nadh --> h2o + ipdp + nad


    Ligand Information
    Model TM1444
    generated 12/2008

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch