.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00872

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP00872
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26396,99287, 16763528 TM0138 Molecular Weight 7049.44 Da.
    Residues 63 Isoelectric Point 4.42
    Sequence msdvtvvncptcgkpvvwgeispfrpfcskrcqlidlgewaaeekriassgdqsdsddwseer
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0138

    Name: tryptophan synthase (indole)
    Other genes that carryout this rxn:TM0539
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : indole + ser-L --> h2o + trp-L
    Classification: EC:4.2.1.20
     
    Name: tryptophan synthase (indoleglycerol phosphate)
    Other genes that carryout this rxn: TM0137 TM0539
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : 3ig3p + ser-L <==> g3p + h2o + trp-L
    Classification: EC:4.2.1.20
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0138
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch