The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP00910
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26320,99287, 16763580 TM0190 Molecular Weight 93862.50 Da.
    Residues 840 Isoelectric Point 9.25
    Sequence magndrepigrkgkpsrpvkqkvsrrrqhdddydddyedeepmprkgkgkgrkprgkrgwlwlllklfiv fvvlfaiygvyldqkirsridgkvwqlpaavygrmvnlepdmpvsknemvklleatqyrlvtkmtrpge ftvqansiemirrpfdfpdskegqvrarltfsdgrletivnldnnrqfgffrldprlitmlsspngeqr lfvprsgfpdllvdtllatedrhfyehdgislysigravlanltagrtvqgastltqqlvknlflsser sywrkaneaymalimdaryskdrilelymnevylgqsgdneirgfplaslyyfgrpveelsldqqallv gmvkgasiynpwrnpklalerrnlvlrllqqqkiidqelydmlsarplgvqprggvispqpafmqmvrq elqaklgdkikdlsgvkifttfdsvaqdaaekavvegipalkkqrklsdletamvvvdrfsgevramvg gaepqyagynramqarrsigslakpatyltalsqpnlyrlntwiadapislrqpngqvwspqnddrrys esgkvmlvdaltrsmnvptvnlgmalglpavtdtwtklgvpkdqlnpvpamllgalnltpievaqafqt iasggnraplsalrsviaedgkvlyqsypqaeravpaqaayltlwtmqqvvqrgtgrqlgakypglhla gktgttnnnvdtwfagidgsqvtitwvgrdnnqptklygasgamaiyqrylanqtptplvltppedvvd mgvdydgnfvcsggmrtlpvwtddpntlcqqgemmqqqqqpsgnpfdqssqpqqpaqqqppkeeksdgv agwikemfggn
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0190

    Name: iron (III) transport via ABC system
    Other genes that carryout this rxn:TM0080 TM0079 TM0078 TM0189 TM0191
    Metabolic Subsystem: Transport
    Reaction: atp[c] + fe3[e] + h2o[c] --> adp[c] + fe3[c] + h[c] + pi[c]


    Ligand Information
    Model TM0190
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch