.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00911

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP00911
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26230,99287, 16763581 TM0191 Molecular Weight 80622.52 Da.
    Residues 729 Isoelectric Point 5.30
    Sequence marlktaqpnsslrkiavvvatavsgmsvyaqaavqpkeetitvtaapaaqesawgpaptiaakrsattt ktdtpiektpqsvsvvtneemqmhqfqsvkealgytpgvtvssrgasntydfviirgfssvglsqnnyl dglklqgnfyndavidpymlervelmrgptsvlygksnpggiismvskrptteplkeiqfkmgtdnlfq tgfdfsdslddngefsyrltglarstneqqkssesqryaiapsftwrpdektnftflsyfqnepetgyy gwlpkegtveplpngkrlptdfnegasnntysrnekmvgysfehgfndtftvrqnlrfvemktaqksvy gtgiaadghtlnrgtivdnerlqnfsvdtqleskfatgdidhtlltgvdfmrmrndinatfgsapsidl ynnyhpeyfafggaepyqmneskqtglyvqdqaewnkwvftlggrydwskqattvrqnsttptegyier ndhqftwrggvnyvfdngispyfsysqsfepsafdlwstprvsykpskgeqyeagvkyvpkdmpvvvtg avyqltktnnltadptnplaqvpageirargveleakaaltaninmtasytytdaeytkdtnlkgntpe qvpehmaslwgdytfnegplsgltlgtggrfigssygdpansfkvgsaavmdavvkydlarfgmagssi avnvnnlldreyvascfqtygcfwgaerqvvatatfrf
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0191

    Name: iron (III) transport via ABC system
    Other genes that carryout this rxn:TM0080 TM0079 TM0078 TM0189 TM0190
    Metabolic Subsystem: Transport
    Reaction: atp[c] + fe3[e] + h2o[c] --> adp[c] + fe3[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0191
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch