.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00915

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00915
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26386,99287, 16763626 TM0236 Molecular Weight 48401.89 Da.
    Residues 430 Isoelectric Point 8.20
    Sequence mttltlntsllssrrilaafsggldstvllhqlvlwrerhpdvtlraihihhglsphadswvrhcetvce rwqvplvvervtladnglgieaharearyrafaqtllpgevlataqhlddqcetfllalkrgsgpagls amgerspfagtlllrpllretrktleqwavrhglcwiedesnqddaydrnflrlralpllqqrwphfpa avarsatlcaeqerlldellasdltdcitaegtlrlsplmsmsdvrraailrrwlamrnapmpsrdale riwqevalarddaspclrfgdheirryqsqlwwiksvagqhettvawpvwqtplalpaglgtvqlvpgg elrrpreeesvsirfkapgvlhivgrnggrklkkiwqeqgippwrrdttpllfygetliaaagvfvtre gaaedkegvslvwha
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0236

    Name: UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D-alanyl-D-alanine synthetase (gamma-glutamate)
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : alaala + atp + uGgl --> adp + pi + uGgla
    Classification: EC:6.3.2.10
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0236
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch