.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00916

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00916
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS33101,99287, 16763636 TM0247 Molecular Weight 37659.20 Da.
    Residues 343 Isoelectric Point 6.01
    Sequence miklsnitkvfqqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerptegsvqvggqelt tlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkeeikrrvtelldlvglgdkhdsypa nlsggqkqrvaiaralasnpkvllcdeatsaldpattrsilellkdinrrlgltillithemdvvkric dcvavisngelieqdtvsevfshpktplaqkfiqstlhldipedyqarlkaspetdsvpmlrmeftgqs vdapllsetarrfnvnnniisaqmdyaggvkfgimltemhgtqeetqaaiawlqdhhvkvevlgyv
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0247

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch