.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00922

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP00922
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32638,99287, 16763913 TM0533 Molecular Weight 39139.69 Da.
    Residues 355 Isoelectric Point 5.78
    Sequence mkqvcvlgngqlgrmlrqageplgiavwpvgldaeptavpvqqsvitaeierwpetaltrelarhpafvn rdvfpiiadrltqkqlfdklglatapwqlltstdewsgifdrlgelaiikrrvggydgrgqwrlradet gqlpddcygecivergihfsgevslvgarahdgstvfyplthnlhqdgilrtsvafpqanaeqqeqaes mlsaimqalnyvgvmamecfitpegllinelaprvhnsghwtqngasisqfelhlraitglplpapvin apsvminligselnydwlklplvhlhwydkavrpgrkvghlnltdsdtsrlsatlealspllpgeyasg iiwaqsklk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0533
    generated 12/2008
    Transmembrane protein

    HMM_TM0533

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch